SLIRP Rabbit Polyclonal Antibody

SKU TA343941

Rabbit Polyclonal Anti-C14ORF156 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C14ORF156 antibody: synthetic peptide directed towards the N terminal of human C14ORF156. Synthetic peptide located within the following region: PFDKETGFHRGLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: SRA stem-loop interacting RNA binding protein
• Database Link:
  NP_112487
  Q9GZT3
• Background: As a RNA-binding protein, C14orf156 acts as a nuclear receptor corepressor. It probably acts by binding the SRA RNA, and repressing the SRA-mediated nuclear receptor coactivation. C14orf156 binds the STR7 loop of SRA RNA. It is also able to repress glucocorticoid (GR), androgen (AR), thyroid (TR) and VDR-mediated transactivation.
• Synonyms: C14orf156; DC50; PD04872
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Dog: 79%; Pig: 79%

Reference Data