MRM1 Rabbit Polyclonal Antibody

SKU TA343934

Rabbit Polyclonal Anti-MRM1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRM1 antibody: synthetic peptide directed towards the C terminal of human MRM1. Synthetic peptide located within the following region: GTVGCPSTEDPQSSEIPIMSCLEFLWERPTLLVLGNEGSGLSQEVQASCQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 18 kDa
• Gene Name: mitochondrial rRNA methyltransferase 1
• Database Link:
  NP_079140
  Q6IN84
• Background: MRM1 belongs to the RNA methyltransferase trmH family and probably methylates the ribose of guanosine G-2270 in the peptidyl transferase center of the mitochondrial large ribosomal RNA (21S)
• Synonyms: FLJ22578
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 91%; Bovine: 86%

Reference Data