RBM22 Rabbit Polyclonal Antibody

SKU TA343867

Rabbit Polyclonal Anti-RBM22 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM22 antibody: synthetic peptide directed towards the C terminal of human RBM22. Synthetic peptide located within the following region: KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: RNA binding motif protein 22
• Database Link:
  NP_060517
  Q9NW64
• Background: RBM22 may be involved in pre-mRNA splicing.
• Synonyms: Cwc2; fSAP47; ZC3H16
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%

Reference Data

• Protein Pathways: Spliceosome