TRSPAP1 (TRNAU1AP) Rabbit Polyclonal Antibody

SKU TA343863

Rabbit Polyclonal Anti-TRSPAP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRSPAP1 antibody: synthetic peptide directed towards the N terminal of human TRSPAP1. Synthetic peptide located within the following region: PGATPAKRFKLNYATYGKQPDNSPEYSLFVGDLTPDVDDGMLYEFFVKVY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 32 kDa
• Gene Name: tRNA selenocysteine 1 associated protein 1
• Database Link:
  NP_060316
  Q9NX07
• Background: TRSPAP1 is involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. It stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. It may be involved in the methylation of tRNA(Sec) and enhances efficiency of selenoproteins synthesis.
• Synonyms: PRO1902; SECP43; TRSPAP1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data