TRSPAP1 (TRNAU1AP) Rabbit Polyclonal Antibody

SKU
TA343862
Rabbit Polyclonal Anti-TRSPAP1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRSPAP1 antibody: synthetic peptide directed towards the middle region of human TRSPAP1. Synthetic peptide located within the following region: KPVEYSQMYSYSYNQYYQQYQNYYAQWGYDQNTGSYSYSYPQYGYTQSTM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 32 kDa
Gene Name tRNA selenocysteine 1 associated protein 1
Database Link
Background TRSPAP1 is involved in the early steps of selenocysteine biosynthesis and tRNA(Sec) charging to the later steps resulting in the cotranslational incorporation of selenocysteine into selenoproteins. It stabilizes the SECISBP2, EEFSEC and tRNA(Sec) complex. It may be involved in the methylation of tRNA(Sec) and enhances efficiency of selenoproteins synthesis.
Synonyms PRO1902; SECP43; TRSPAP1
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 82%
Reference Data
Write Your Own Review
You're reviewing:TRSPAP1 (TRNAU1AP) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.