CPSF73 (CPSF3) Rabbit Polyclonal Antibody

SKU TA343845

Rabbit Polyclonal Anti-CPSF3 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CPSF3 antibody: synthetic peptide directed towards the C terminal of human CPSF3. Synthetic peptide located within the following region: DDSILSVTVDGKTANLNLETRTVECEEGSEDDESLREMVELAAQRLYEAL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 75 kDa
• Gene Name: cleavage and polyadenylation specific factor 3
• Database Link:
  NP_057291
  Q9UKF6
• Background: CPSF3 belongs to the RNA-metabolizing metallo-beta-lactamase-like family, CPSF3 subfamily. It is component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition.
• Synonyms: CPSF-73; CPSF73
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Rabbit: 86%

Reference Data