EXOSC3 Rabbit Polyclonal Antibody

SKU
TA343836
Rabbit Polyclonal Anti-EXOSC3 Antibody
$525.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-EXOSC3 antibody: synthetic peptide directed towards the C terminal of human EXOSC3. Synthetic peptide located within the following region: PLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name exosome component 3
Database Link
Background EXOSC3 is component of the exosome 3'->5' exoribonuclease complex and is required for the 3' processing of the 7S pre-RNA to the mature 5.8S rRNA.
Synonyms bA3J10.7; CGI-102; hRrp-40; p10; PCH1B; RRP40; Rrp40p
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 92%; Mouse: 85%; Guinea pig: 85%
Reference Data
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:EXOSC3 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.