RBFOX2 Rabbit Polyclonal Antibody

SKU TA343808

Rabbit Polyclonal Anti-RBM9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RBM9 antibody: synthetic peptide directed towards the middle region of human RBM9. Synthetic peptide located within the following region: PPTAIPAYPGVDMQPTDMHSLLLQPQPPLLQPLQPLTVTVMAGCTQPTPT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: RNA binding protein, fox-1 homolog 2
• Database Link:
  NP_055124
  O43251
• Background: RBM9 is a RNA-binding protein that seems to act as a coregulatory factor of ER-alpha.
• Synonyms: dJ106I20.3; Fox-2; FOX2; fxh; HNRBP2; HRNBP2; RBM9; RTA
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 93%; Horse: 85%; Yeast: 85%; Goat: 76%; Bovine: 75%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors