ADAT1 Rabbit Polyclonal Antibody

SKU TA343780

Rabbit Polyclonal Anti-ADAT1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADAT1 antibody: synthetic peptide directed towards the C terminal of human ADAT1. Synthetic peptide located within the following region: RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: adenosine deaminase, tRNA specific 1
• Database Link:
  NP_036223
  Q9BUB4
• Background: ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.
• Synonyms: HADAT1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%

Reference Data