ZNF423 Rabbit Polyclonal Antibody

SKU TA343766

Rabbit Polyclonal Anti-ZNF423 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF423 antibody: synthetic peptide directed towards the middle region of human ZNF423. Synthetic peptide located within the following region: CFTVFVQANKLQQHIFAVHGQEDKIYDCSQCPQKFFFQTELQNHTMSQHA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 144 kDa
• Gene Name: zinc finger protein 423
• Database Link:
  NP_055884
  Q2M1K9
• Background: ZNF423 is the transcription factor that can both act as an activator or a repressor depending on the context. ZNF423 plays a central role in BMP signaling and olfactory neurogenesis. ZNF423 is associates with SMADs in response to BMP2 leading to activate
• Synonyms: Ebfaz; JBTS19; NPHP14; OAZ; Roaz; Zfp104; ZFP423
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data