ZBTB43 Rabbit Polyclonal Antibody

SKU TA343718

Rabbit Polyclonal Anti-ZBTB43 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB43 antibody: synthetic peptide directed towards the N terminal of human ZBTB43. Synthetic peptide located within the following region: EPGTNSFRVEFPDFSSTILQKLNQQRQQGQLCDVSIVVQGHIFRAHKAVL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: zinc finger and BTB domain containing 43
• Database Link:
  NP_054726
  O43298
• Background: ZBTB43 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 1 BTB (POZ) domain and 3 C2H2-type zinc fingers. ZBTB43 may be involved in transcriptional regulation.
• Synonyms: ZBTB22B; ZNF-X; ZNF297B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Yeast: 90%

Reference Data

• Protein Families: Transcription Factors