KAT6B Rabbit Polyclonal Antibody

SKU TA343698

Rabbit Polyclonal Anti-MYST4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYST4 antibody: synthetic peptide directed towards the N terminal of human MYST4. Synthetic peptide located within the following region: MVKLANPLYTEWILEAIQKIKKQKQRPSEERICHAVSTSHGLDKKTVSEQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 231 kDa
• Gene Name: lysine acetyltransferase 6B
• Database Link:
  NP_001243397
  Q8WYB5
• Background: MYST4 is a histone acetyltransferase which may be involved in both positive and negative regulation of transcription. It is required for RUNX2-dependent transcriptional activation and May be involved in cerebral cortex development.
• Synonyms: GTPTS; MORF; MOZ2; MYST4; qkf; querkopf; ZC2HC6B
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome