CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

SKU TA343682

Rabbit Polyclonal Anti-CIZ1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 100 kDa
• Gene Name: CDKN1A interacting zinc finger protein 1
• Database Link:
  NP_036259
  Q9ULV3
• Background: CIZ1 may regulate the subcellular localization of CIP/WAF1.
• Synonyms: LSFR1; NP94; ZNF356
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 77%

Reference Data