CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody

SKU
TA343682
Rabbit Polyclonal Anti-CIZ1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CIZ1 antibody: synthetic peptide directed towards the C terminal of human CIZ1. Synthetic peptide located within the following region: YKAAKNPSPTTRPVSRRCAINARNALTALFTSSGRPPSQPNTQDKTPSKV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 100 kDa
Gene Name CDKN1A interacting zinc finger protein 1
Database Link
Background CIZ1 may regulate the subcellular localization of CIP/WAF1.
Synonyms LSFR1; NP94; ZNF356
Note Immunogen Sequence Homology: Human: 100%; Horse: 77%
Reference Data
Write Your Own Review
You're reviewing:CDKN1A interacting zinc finger protein 1 (CIZ1) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.