ZNF195 Rabbit Polyclonal Antibody

SKU TA343663

Rabbit Polyclonal Anti-ZNF195 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF195 antibody: synthetic peptide directed towards the N terminal of human ZNF195. Synthetic peptide located within the following region: LTFRDVAIEFSLEEWKCLDLAQQNLYRDVMLENYRNLFSVGLTVCKPGLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 72 kDa
• Gene Name: zinc finger protein 195
• Database Link:
  NP_009083
  O14628
• Background: ZNF195 contains 1 KRAB domain and 10 C2H2-type zinc fingers and belongs to the krueppel C2H2-type zinc-finger protein family. It may be involved in transcriptional regulation.
• Synonyms: HRF1; ZNFP104
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transcription Factors