Calpain 15 (CAPN15) Rabbit Polyclonal Antibody

SKU TA343546

Rabbit Polyclonal Anti-SOLH Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SOLH antibody: synthetic peptide directed towards the middle region of human SOLH. Synthetic peptide located within the following region: FNVVSTRGSLRTQDSVPPLHRQVLVILSQLEGNAGFSITHRLAHRKAAQA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 117 kDa
• Gene Name: calpain 15
• Database Link:
  NP_005623
  O75808
• Background: SOLH is a protein containing zinc-finger-like repeats and a calpain-like protease domain. SOLH may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.This gene encodes a protein containing zinc-finger-like repeats and a calpain-like protease domain. The encoded protein may function as a transcription factor, RNA-binding protein, or in protein-protein interactions during visual system development.
• Synonyms: SOLH
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome