TP53BP2 Rabbit Polyclonal Antibody

SKU TA343538

Rabbit Polyclonal Anti-TP53BP2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TP53BP2 antibody: synthetic peptide directed towards the N terminal of human TP53BP2. Synthetic peptide located within the following region: TLAELQEMASRQQQQIEAQQQLLATKEQRLKFLKQQDQRQQQQVAEQEKL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 124 kDa
• Gene Name: tumor protein p53 binding protein 2
• Database Link:
  NP_001026855
  Q13625
• Background: TP53BP2 is a member of the ASPP (apoptosis-stimulating protein of p53) family of p53 interacting proteins. TP53BP2 contains four ankyrin repeats and an SH3 domain involved in protein-protein interactions. TP53BP2 is localized to the perinuclear region of the cytoplasm, and regulates apoptosis and cell growth through interactions with other regulatory molecules including members of the p53 family.
• Synonyms: 53BP2; ASPP2; BBP; P53BP2; PPP1R13A
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome