NFKBIL1 Rabbit Polyclonal Antibody

SKU
TA343495
Rabbit Polyclonal Anti-NFKBIL1 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-NFKBIL1 antibody: synthetic peptide directed towards the N terminal of human NFKBIL1. Synthetic peptide located within the following region: MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 43 kDa
Gene Name NFKB inhibitor like 1
Database Link
Background NFKBIL1 is a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isofor
Synonyms IKBL; LST1; NFKBIL
Note Immunogen Sequence Homology: Pig: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rat: 93%; Dog: 86%; Rabbit: 86%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:NFKBIL1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.