LRRFIP1 Rabbit Polyclonal Antibody

SKU
TA343482
Rabbit Polyclonal Anti-LRRFIP1 Antibody
$585.00
2 Weeks*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-LRRFIP1 antibody: synthetic peptide directed towards the N terminal of human LRRFIP1. Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 86 kDa
Gene Name leucine rich repeat (in FLII) interacting protein 1
Database Link
Background LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury throu
Synonyms FLAP-1; FLAP1; FLIIAP1; GCF-2; GCF2; HUFI-1; TRIP
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 90%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:LRRFIP1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.