LRRFIP1 Rabbit Polyclonal Antibody

SKU TA343482

Rabbit Polyclonal Anti-LRRFIP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LRRFIP1 antibody: synthetic peptide directed towards the N terminal of human LRRFIP1. Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 86 kDa
• Gene Name: leucine rich repeat (in FLII) interacting protein 1
• Database Link:
  NP_004726
  Q32MZ4
• Background: LRRFIP1 is a transcriptional repressor which preferentially binds to the GC-rich consensus sequence (5'-AGCCCCCGGCG-3') and may regulate expression of TNF, EGFR and PDGFA. LRRFIP1 may control smooth muscle cells proliferation following artery injury throu
• Synonyms: FLAP-1; FLAP1; FLIIAP1; GCF-2; GCF2; HUFI-1; TRIP
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Yeast: 90%

Reference Data

• Protein Families: Transcription Factors