Cip4 (TRIP10) Rabbit Polyclonal Antibody

SKU TA343450

Rabbit Polyclonal Anti-TRIP10 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TRIP10 antibody: synthetic peptide directed towards the middle region of human TRIP10. Synthetic peptide located within the following region: FEGSSEGTISMAEGEDLSLMEEDKGDGWTRVRRKEGGEGYVPTSYLRVTL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: thyroid hormone receptor interactor 10
• Database Link:
  NP_004231
  Q15642
• Background: TRIP10 is in FNBP1 family of proteins.
• Synonyms: CIP4; HSTP; STOT; STP; TRIP-10
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Bovine: 93%; Guinea pig: 93%; Mouse: 86%; Rabbit: 79%; Zebrafish: 79%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Insulin signaling pathway