ZNF282 Rabbit Polyclonal Antibody

SKU TA343413

Rabbit Polyclonal Anti-ZNF282 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF282 antibody: synthetic peptide directed towards the C terminal of human ZNF282. Synthetic peptide located within the following region: FIRKQNLLKHQRIHTGERPYTCGECGKSFRYKESLKDHLRVHSGGPGPGA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 74 kDa
• Gene Name: zinc finger protein 282
• Database Link:
  NP_003566
  Q9UDV7
• Background: ZNF282 contains 1 KRAB domain and 5 C2H2-type zinc fingers. It belongs to the krueppel C2H2-type zinc-finger protein family and binds to the U5 repressive element (U5RE) of the human T cell leukemia virus type I long terminal repeat.
• Synonyms: HUB1
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Pig: 93%; Zebrafish: 83%; Dog: 79%; Horse: 79%; Guinea pig: 75%

Reference Data

• Protein Families: Transcription Factors