ZFP200 (ZNF200) Rabbit Polyclonal Antibody

SKU TA343406

Rabbit Polyclonal Anti-ZNF200 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF200 antibody: synthetic peptide directed towards the middle region of human ZNF200. Synthetic peptide located within the following region: SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 45 kDa
• Gene Name: zinc finger protein 200
• Database Link:
  NP_003445
  P98182
• Background: ZNF200 contains 5 C2H2-type zinc fingers. ZNF200 could have a role in spermatogenesis.
• Synonyms: MGC45293
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 86%; Bovine: 77%

Reference Data

• Protein Families: Transcription Factors