Spt6 (SUPT6H) Rabbit Polyclonal Antibody

SKU TA343365

Rabbit Polyclonal Anti-SUPT6H Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SUPT6H antibody: synthetic peptide directed towards the N terminal of human SUPT6H. Synthetic peptide located within the following region: EAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 199 kDa
• Gene Name: SPT6 homolog, histone chaperone
• Database Link:
  NP_003161
  Q7KZ85
• Background: SUPT6H may be functionally analogous to SPT6 and emb-5 and may therefore regulate transcription through establishment or maintenance of chromatin structure. Spt6 may also participates in the regulation of transcription by RNA polymerase II (RNAPII). Human Spt6 (hSpt6) is a classic transcription elongation factor that enhances the rate of RNAPII elongation. HSpt6 is capable of stimulating transcription elongation both individually and in concert with DRB sensitivity-inducing factor (DSIF).
• Synonyms: emb-5; SPT6; SPT6H
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Yeast: 77%; Zebrafish: 77%

Reference Data

• Protein Families: Transcription Factors