TAPA1 (CD81) Rabbit Polyclonal Antibody

SKU TA343281

Rabbit Polyclonal Anti-CD81 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: Formalin Fixed Paraffin Embedded Tissue (Human Liver Tissue): 1:100
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: CD81 molecule
• Database Link:
  NP_004347
  P60033
• Background: The function of this protein remains unknown.
• Synonyms: CVID6; S5.7; TAPA1; TSPAN28
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 92%; Pig: 86%; Goat: 83%; Bovine: 83%; Horse: 75%

Reference Data

• Protein Families: Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
• Protein Pathways: B cell receptor signaling pathway