OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TAPA1 (CD81) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343281
Rabbit Polyclonal Anti-CD81 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (3)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
30 ul
$200.00
LY418041 Transient overexpression lysate of CD81 molecule (CD81) (as WB positive control)
100 ug
$436.00
TP317508 Recombinant protein of human CD81 molecule (CD81), 20 µg
20 ug
$867.00

View other "TAPA1 or NM_004356" antibodies

Specifications
Specifications
Product Data
Application IHC, WB
Recommended Dilution Formalin Fixed Paraffin Embedded Tissue (Human Liver Tissue): 1:100
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 30 kDa
Gene Name CD81 molecule
Database Link
Background The function of this protein remains unknown.
Synonyms CVID6; S5.7; TAPA1; TSPAN28
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 92%; Pig: 86%; Goat: 83%; Bovine: 83%; Horse: 75%
Reference Data
Protein Categories CD Markers, Cytokines, Immune system diseases, Membrane Proteins
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways B cell receptor signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products