ADCK2 Rabbit Polyclonal Antibody

SKU TA343272

Rabbit Polyclonal Anti-ADCK2 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADCK2 antibody is: synthetic peptide directed towards the middle region of Human ADCK2. Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 68 kDa
• Gene Name: aarF domain containing kinase 2
• Database Link:
  NP_443085
  Q7Z695
• Background: The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
• Synonyms: AARF
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase