ADCK2 Rabbit Polyclonal Antibody

CAT#: TA343272

Rabbit Polyclonal Anti-ADCK2 Antibody

Product Images

Host: Rabbit; Target Name: ADCK2; Sample Tissue: Jurkat Whole Cell lysates; Antibody Dilution: 1.0 ug/ml ADCK2 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-ADCK2 Antibody; Formalin Fixed Paraffin Embedded Tissue: Human Adult Liver; Observed Staining: Membrane in bile canaliculi, strong signal, wide tissue distribution; Primary Antibody Concentration: 1:100; Secondary Antibody: donkey anti-rabbit

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ADCK2 antibody is: synthetic peptide directed towards the middle region of Human ADCK2. Synthetic peptide located within the following region: LGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQPEATNLI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 68 kDa
• Gene Name: aarF domain containing kinase 2
• Database Link:
  NP_443085
  Entrez Gene 90956 Human
  UniProt ID Q7Z695
• Background: The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr)
• Synonyms: AARF
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase