THTPA Rabbit Polyclonal Antibody

SKU TA343262

Rabbit Polyclonal Anti-THTPA Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-THTPA antibody is: synthetic peptide directed towards the N-terminal region of Human THTPA. Synthetic peptide located within the following region: KFLPGPGTEERLQELGGTLEYRVTFRDTYYDTPELSLMQADHWLRRREDS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 25 kDa
• Gene Name: thiamine triphosphatase
• Database Link:
  NP_077304
  Q9BU02
• Background: This gene encodes an enzyme which catalyzes the biosynthesis of thiamine disphophate (vitamin B1) by hydrolysis of thiamine triphosphate. Alternative splicing results in multiple transcript variants.
• Synonyms: THTP; THTPASE
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Bovine: 93%; Mouse: 92%; Rabbit: 92%; Dog: 85%

Reference Data

• Protein Pathways: Metabolic pathways, Thiamine metabolism