C10orf97 (FAM188A) Rabbit Polyclonal Antibody

SKU TA343239

Rabbit Polyclonal Anti-FAM188A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Fam188a antibody is: synthetic peptide directed towards the N-terminal region of Rat Fam188a. Synthetic peptide located within the following region: CAVIAPVQAFLLKKLLFSSEKSSWRDCSEDEQKELLCHTLCDILESACDS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: family with sequence similarity 188 member A
• Database Link:
  NP_079224
  Q9H8M7
• Background: The function of this protein remaining unknown.
• Synonyms: C10orf97; CARP; DERP5; MST126; MSTP126; my042
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%

Reference Data

• Protein Families: Druggable Genome