ELL3 Rabbit Polyclonal Antibody

SKU
TA343230
Rabbit Polyclonal Anti-ELL3 Antibody
$575.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Ell3 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ell3. Synthetic peptide located within the following region: PEHKVLEDKIVQEYKKFRKRYPSYREEKHRCEYLHQKLSHIKGLILEFEE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 45 kDa
Gene Name elongation factor for RNA polymerase II 3
Database Link
Background Ell3 is an elongation factor that can increase the catalytic rate of RNA polymerase II transcription by suppressing transient pausing by the polymerase at multiple sites along the DNA.
Synonyms FLJ22637
Note Immunogen Sequence Homology: Human: 100%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Pig: 79%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ELL3 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.