COL21A1 Rabbit Polyclonal Antibody

SKU TA343211

Rabbit Polyclonal Anti-COL21A1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-COL21A1 antibody is: synthetic peptide directed towards the C-terminal region of Human COL21A1. Synthetic peptide located within the following region: PGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 35 kDa
• Gene Name: collagen type XXI alpha 1 chain
• Database Link:
  NP_110447
  Q96P44
• Background: This gene encodes the alpha chain of type XXI collagen, a member of the FACIT collagen family (fibril-associated collagens with interrupted helices). Type XXI collagen is localized to tissues containing type I collagen so, like other members of this collagen family, it may serve to maintain the integrity of the extracellular matrix. An alternatively spliced transcript variant has been described, but its full-length nature has yet to be determined.
• Synonyms: COLA1L; dJ682J15.1; dJ708F5.1; FP633
• Note: Immunogen Sequence Homology: Pig: 100%; Horse: 100%; Human: 100%; Dog: 93%

Reference Data