RAD51D Rabbit Polyclonal Antibody

SKU
TA343160
Rabbit Polyclonal Anti-RAD51D Antibody
  $585.00
5 Days*
Bulk/Customize
Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-RAD51D antibody is: synthetic peptide directed towards the C-terminal region of Human RAD51D. Synthetic peptide located within the following region: RLKPALGRSWSFVPSTRILLDTIEGAGASGGRRMACLAKSSRQPTGFQEM
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 34 kDa
Gene Name RAD51 paralog D
Database Link
Background The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, which are known to be involved in the homologous recombination and repair of DNA. This protein forms a complex with several other members of the RAD51 family, including RAD51L1, RAD51L2, and XRCC2. The protein complex formed with this protein has been shown to catalyze homologous pairing between single- and double-stranded DNA, and is thought to play a role in the early stage of recombinational repair of DNA. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the downstream ring finger and FYVE-like domain containing 1 (RFFL) gene.
Synonyms BROVCA4; R51H3; RAD51L3; TRAD
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Mouse: 79%
Reference Data
Protein Categories Cancer: Gynecologic, Intracellular Proteins
Protein Families Druggable Genome
Protein Pathways Homologous recombination
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.