ARMER (ARL6IP1) Rabbit Polyclonal Antibody
Product Data | |
Recommended Dilution | WB |
---|---|
Reactivity | Rat |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Arl6ip1 antibody is: synthetic peptide directed towards the middle region of Rat Arl6ip1. Synthetic peptide located within the following region: GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRR |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 22 kDa |
Gene Name | ADP ribosylation factor like GTPase 6 interacting protein 1 |
Database Link | |
Background | Mouse homolog interacts with ADP-ribosylation-like factor-6 (ARL6); Arl6ip1 may play a role in hematopoetic maturation. |
Synonyms | AIP1; ARL6IP; ARMER; SPG61 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93% |
Reference Data | |
Protein Families | Transmembrane |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.