ARMER (ARL6IP1) Rabbit Polyclonal Antibody

SKU TA343158

Rabbit Polyclonal Anti-ARL6IP1 Antibody

Product Data

• Recommended Dilution: WB
• Reactivity: Rat
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Arl6ip1 antibody is: synthetic peptide directed towards the middle region of Rat Arl6ip1. Synthetic peptide located within the following region: GVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 22 kDa
• Gene Name: ADP ribosylation factor like GTPase 6 interacting protein 1
• Database Link:
  NP_055976
  Q15041
• Background: Mouse homolog interacts with ADP-ribosylation-like factor-6 (ARL6); Arl6ip1 may play a role in hematopoetic maturation.
• Synonyms: AIP1; ARL6IP; ARMER; SPG61
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%; Goat: 93%

Reference Data

• Protein Families: Transmembrane