Phosphoglucomutase 5 (PGM5) Rabbit Polyclonal Antibody

SKU TA343132

Rabbit Polyclonal Anti-PGM5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PGM5 antibody: synthetic peptide directed towards the N terminal of human PGM5. Synthetic peptide located within the following region: IPVLTVPTAPYEDQRPAGGGGLRRPTGLFEGQRNYLPNFIQSVLSSIDLR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 56 kDa
• Gene Name: phosphoglucomutase 5
• Database Link:
  NP_068800
  Q15124
• Background: Phosphoglucomutases (EC 5.2.2.2.), such as PGM5, are phosphotransferases involved in interconversion of glucose-1-phosphate and glucose-6-phosphate. PGM activity is essential in formation of carbohydrates from glucose-6-phosphate and in formation of glucose-6-phosphate from galactose and glycogen.
• Synonyms: PGMRP
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data

• Protein Families: Druggable Genome