INCA (CARD17) Rabbit Polyclonal Antibody

SKU TA343129

Rabbit Polyclonal Anti-CARD17 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CARD17 antibody: synthetic peptide directed towards the middle region of human CARD17. Synthetic peptide located within the following region: MDKARALLDSVIRKGAPACQICITYICEEDSHLAGTLGLSAGPTSGNHLT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: caspase recruitment domain family member 17
• Database Link:
  NP_001007233
  Q5XLA6
• Background: As a regulator of procaspase-1/CASP1 activation, CARD17 is implicated in the regulation of the proteolytic maturation of pro-IL-1beta/IL1B and its release during inflammation. CARD17 inhibits the release of IL1B in response to LPS in monocytes. However, unlike CASP1, CARD17 do not induce NF-kappa-B activation.
• Synonyms: INCA
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data