Clusterin (CLU) Rabbit Polyclonal Antibody

SKU
TA343117
Rabbit Polyclonal Anti-CLU Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CLU antibody: synthetic peptide directed towards the C terminal of human CLU. Synthetic peptide located within the following region: CREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 58 kDa
Gene Name clusterin
Database Link
Background The protein encoded by this gene is a secreted chaperone that can under some stress conditions also be found in the cell cytosol. It has been suggested to be involved in several basic biological events such as cell death, tumor progression, and neurodegenerative disorders. Alternate splicing results in both coding and non-coding variants.
Synonyms AAG4; APO-J; APOJ; CLI; CLU1; CLU2; KUB1; NA1; NA2; SGP-2; SGP2; SP-40; TRPM-2; TRPM2
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 91%; Pig: 86%; Rat: 86%; Mouse: 86%; Guinea pig: 86%
Reference Data
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:Clusterin (CLU) Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.