Calpain 1 (CAPN1) Rabbit Polyclonal Antibody

SKU TA343085

Rabbit Polyclonal Anti-CAPN1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CAPN1 antibody: synthetic peptide directed towards the middle region of human CAPN1. Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 82 kDa
• Gene Name: calpain 1
• Database Link:
  NP_005177
  P07384
• Background: The calpains, calcium-activated neutral proteases, are nonlysosomal, intracellular cysteine proteases. The mammalian calpains include ubiquitous, stomach-specific, and muscle-specific proteins. The ubiquitous enzymes consist of heterodimers with distinct large, catalytic subunits associated with a common small, regulatory subunit. This gene encodes the large subunit of the ubiquitous enzyme, calpain 1. Several transcript variants encoding two different isoforms have been found for this gene.
• Synonyms: CANP; CANP1; CANPL1; muCANP; muCL
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Rat: 83%; Mouse: 80%; Goat: 79%; Sheep: 79%; Bovine: 79%; Rabbit: 79%; Zebrafish

Reference Data

• Protein Families: Druggable Genome, Protease
• Protein Pathways: Alzheimer's disease, Apoptosis