1 AGP acyltransferase 4 (AGPAT4) Rabbit Polyclonal Antibody

SKU TA343074

Rabbit Polyclonal Anti-AGPAT4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: 1-acylglycerol-3-phosphate O-acyltransferase 4
• Database Link:
  NP_064518
  Q9NRZ5
• Background: This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. This integral membrane protein converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis.
• Synonyms: 1-AGPAT4; dJ473J16.2; LPAAT-delta
• Note: Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Horse: 92%; Zebrafish: 90%; Dog: 85%; Rat: 85%; Mouse: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Ether lipid metabolism, Glycerolipid metabolism, Glycerophospholipid metabolism, Metabolic pathways