OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Adiponectin Receptor 2 (ADIPOR2) Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA343073
Rabbit Polyclonal Anti-ADIPOR2 Antibody
Size:
100 ul
Conjugation:
Unconjugated
  $585.00
2 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA811000S beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control 30 ul
$200.00
LY403002 Transient overexpression lysate of adiponectin receptor 2 (ADIPOR2) (as WB positive control) 100 ug
$436.00

View other "Adiponectin Receptor 2 or NM_024551" antibodies

Specifications
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ADIPOR2 antibody: synthetic peptide directed towards the N terminal of human ADIPOR2. Synthetic peptide located within the following region: ASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMSPLLQAHHAMEKMEEFVCK
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 44 kDa
Gene Name adiponectin receptor 2
Database Link
Background The adiponectin receptors, ADIPOR1 and ADIPOR2, serve as receptors for globular and full-length adiponectin and mediate increased AMPK and PPAR-alpha ligand activities, as well as fatty acid oxidation and glucose uptake by adiponectin.
Synonyms ACDCR2; PAQR2
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 92%; Pig: 82%; Guinea pig: 82%
Reference Data
Protein Categories Membrane Proteins
Protein Families Druggable Genome, Transmembrane
Protein Pathways Adipocytokine signaling pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources

file-alt Citations

Betaine attenuates chronic alcohol‑induced fatty liver by broadly regulating hepatic lipid metabolism
Yang, Huang, Gao et al
Mol Med Rep (2017) 16 (4), 5225-5234 DOI: 10.3892/mmr.2017.7295
AI Summary: OriGene products, specifically the rabbit streptavidin-peroxidase (cat. no. PV-9003), goat anti-rabbit (cat. no. PV-9001), and goat anti-mouse (cat. no. PV-9002) secondary antibodies, were used for immunohistochemical detection of protein expression in liver tissues to assess the effects of betaine on alcohol-induced fatty liver in this study.
Snippet: cat. no. PV-9003;OriGene Technologies, Inc., Beijing, China), goat anti-rabbit (cat. no. PV-9001;OriGene Technologies, Inc.), or goat anti-mouse (cat. no. PV‑9002;OriGene Technologies, Inc.) at 37˚C for 30 min. Subsequently
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products