Acyl CoA Thioesterase 9 (ACOT9) Rabbit Polyclonal Antibody

SKU TA343072

Rabbit Polyclonal Anti-ACOT9 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ACOT9 antibody: synthetic peptide directed towards the N terminal of human ACOT9. Synthetic peptide located within the following region: TQGPQNPKKQGIFHIHEACSSIHVNHVRDKLREIVGASTNWRDHVKAMEE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 51 kDa
• Gene Name: acyl-CoA thioesterase 9
• Database Link:
  NP_001032248
  Q9Y305
• Background: The protein encoded by this gene is a mitochondrial acyl-CoA thioesterase of unknown function. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: ACATE2; CGI-16; MT-ACT48; MTACT48
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 79%

Reference Data