AKR1D1 Rabbit Polyclonal Antibody

SKU TA343067

Rabbit Polyclonal Anti-AKR1D1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AKR1D1 antibody: synthetic peptide directed towards the middle region of human AKR1D1. Synthetic peptide located within the following region: YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: aldo-keto reductase family 1, member D1
• Database Link:
  NP_005980
  P51857
• Background: The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.
• Synonyms: 3o5bred; CBAS2; SRD5B1
• Note: Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Horse: 93%; Mouse: 92%; Pig: 86%; Bovine: 86%; Rat

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Androgen and estrogen metabolism, C21-Steroid hormone metabolism, Metabolic pathways, Primary bile acid biosynthesis