ACSM3 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACSM3 antibody: synthetic peptide directed towards the C terminal of human ACSM3. Synthetic peptide located within the following region: DQEQLIKEIQEHVKKTTAPYKYPRKVEFIQELPKTISGKTKRNELRKKEW |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 66 kDa |
Gene Name | acyl-CoA synthetase medium-chain family member 3 |
Database Link | |
Background | Q53FZ2 has medium-chain fatty acid:CoA ligase activity with broad substrate specificity (in vitro). It acts on acids from C4 to C(11) and on the corresponding 3-hydroxy- and 2,3- or 3,4-unsaturated acids (in vitro). |
Synonyms | SA; SAH |
Note | Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Horse: 92%; Rat: 86%; Zebrafish: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Butanoate metabolism, Metabolic pathways |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.