PPP1R15B Rabbit Polyclonal Antibody

SKU TA343022

Rabbit Polyclonal Anti-PPP1R15B Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PPP1R15B antibody: synthetic peptide directed towards the C terminal of human PPP1R15B. Synthetic peptide located within the following region: SFCSVDPYNPQNFTATIQTAARIVPEEPSDSEKDLSGKSDLENSSQSGSL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 79 kDa
• Gene Name: protein phosphatase 1 regulatory subunit 15B
• Database Link:
  NP_116222
• Background: PPP1R15B promotes dephosphorylation of the transcription initiation factor EIF2-alpha through recruitment of protein phosphatase-1 (PP1) catalytic subunits.
• Synonyms: CREP; MSSGM2
• Note: Immunogen Sequence Homology: Human: 100%; Bovine: 92%; Dog: 91%

Reference Data

• Protein Families: Druggable Genome