MRO Rabbit Polyclonal Antibody

SKU TA342996

Rabbit Polyclonal Anti-MRO Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MRO antibody: synthetic peptide directed towards the C terminal of human MRO. Synthetic peptide located within the following region: VAKACKTTFQACSPYLKLKEEYSFQSEEDQRNTKLYQQLSHYHPEILQFF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: maestro
• Database Link:
  NP_001120648
  Q9BYG7
• Background: This gene is specifically transcribed in males before and after differentiation of testis, and the encoded protein may play an important role in a mammalian sex determination.
• Synonyms: B29; C18orf3
• Note: Immunogen Sequence Homology: Human: 100%; Mouse: 90%; Dog: 85%; Horse: 85%; Bovine: 85%; Rabbit: 85%; Rat

Reference Data