IMMP2L Rabbit Polyclonal Antibody

SKU TA342985

Rabbit Polyclonal Anti-IMMP2L Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-IMMP2L antibody: synthetic peptide directed towards the N terminal of human IMMP2L. Synthetic peptide located within the following region: LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 20 kDa
• Gene Name: inner mitochondrial membrane peptidase subunit 2
• Database Link:
  NP_115938
  Q96T52
• Background: The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 (IMMP1L; MIM 612323) and IMP2 are the catalytic subunits of the IMP complex.
• Synonyms: IMMP2L-IT1; IMP2; IMP2-LIKE
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 93%

Reference Data

• Protein Families: Druggable Genome, Protease