TUBB6 Rabbit Polyclonal Antibody

CAT#: TA342935

Reviews ()
Write a review

Rabbit Polyclonal Anti-TUBB6 Antibody



USD 539.00

2 Weeks*

Size
    • 100 ul

Product images

Frequently bought together (3)
Recombinant protein of human tubulin, beta 6 (TUBB6)
    • 100 ug

USD 2,950.00


Transient overexpression lysate of tubulin, beta 6 (TUBB6)
    • 100 ug

USD 436.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

USD 200.00

Other products for "TUBB6"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TUBB6 antibody: synthetic peptide directed towards the N terminal of human TUBB6. Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 50 kDa
Gene Name tubulin beta 6 class V
Background Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Synonyms HsT1601; TUBB-5
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Yeast: 85%; Zebrafish: 85%; Guinea pig: 85%
Reference Data
Protein Families Druggable Genome
Protein Pathways Gap junction, Pathogenic Escherichia coli infection
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.