TUBB6 Rabbit Polyclonal Antibody

SKU TA342935

Rabbit Polyclonal Anti-TUBB6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TUBB6 antibody: synthetic peptide directed towards the N terminal of human TUBB6. Synthetic peptide located within the following region: QLERINVYYNESSSQKYVPRAALVDLEPGTMDSVRSGPFGQLFRPDNFIF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 50 kDa
• Gene Name: tubulin beta 6 class V
• Database Link:
  NP_115914
  Q9BUF5
• Background: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
• Synonyms: HsT1601; TUBB-5
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Rat: 93%; Mouse: 93%; Yeast: 85%; Zebrafish: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Pathogenic Escherichia coli infection