RELM beta (RETNLB) Rabbit Polyclonal Antibody

SKU TA342924

Rabbit Polyclonal Anti-RETNLB Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RETNLB antibody: synthetic peptide directed towards the N terminal of human RETNLB. Synthetic peptide located within the following region: CSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 12 kDa
• Gene Name: resistin like beta
• Database Link:
  NP_115968
  Q9BQ08
• Background: RETNLB may play a role as hormone.
• Synonyms: FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Secreted Protein