LTBP1 Rabbit Polyclonal Antibody

SKU TA342898

Rabbit Polyclonal Anti-LTBP1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LTBP1 antibody: synthetic peptide directed towards the C terminal of human LTBP1. Synthetic peptide located within the following region: NVCANGDCSNLEGSYMCSCHKGYTRTPDHKHCRDIDECQQGNLCVNGQCK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 154 kDa
• Gene Name: latent transforming growth factor beta binding protein 1
• Database Link:
  NP_000618
  Q14766
• Background: The protein encoded by this gene belongs to the family of latent TGF-beta binding proteins (LTBPs). The secretion and activation of TGF-betas is regulated by their association with latency-associated proteins and with latent TGF-beta binding proteins. The product of this gene targets latent complexes of transforming growth factor beta to the extracellular matrix, where the latent cytokine is subsequently activated by several different mechanisms.
• Synonyms: MGC163161
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 92%; Bovine: 92%; Rabbit: 92%; Horse: 86%; Pig: 83%; Rat: 83%; Mouse: 83%; Guinea pig: 83%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: TGF-beta signaling pathway