FAM126A Rabbit Polyclonal Antibody

SKU TA342889

Rabbit Polyclonal Anti-FAM126A Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM126A antibody: synthetic peptide directed towards the C terminal of human FAM126A. Synthetic peptide located within the following region: MEISEVDEGFYSRAASSTSQSGLSNSSHNCSNKPSIGKNHRRSGGSKTGG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: family with sequence similarity 126 member A
• Database Link:
  NP_115970
  Q9BYI3
• Background: FAM126A may play a part in the beta-catenin/Lef signaling pathway. Expression of FAM126A gene is down-regulated by beta-catenin. Defects in FAM126A gene are a cause of hypomyelination with congenital cataract (HCC).
• Synonyms: DRCTNNB1A; HCC; HLD5; HYCC1
• Note: Immunogen Sequence Homology: Human: 100%; Pig: 93%; Guinea pig: 93%; Horse: 86%; Rabbit: 86%; Rat: 85%; Mouse: 85%; Dog: 79%; Bovine: 79%

Reference Data