ZNHIT2 Rabbit Polyclonal Antibody

SKU TA342838

Rabbit Polyclonal Anti-ZNHIT2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNHIT2 antibody is: synthetic peptide directed towards the C-terminal region of Human ZNHIT2. Synthetic peptide located within the following region: KGYTLAALGDLAQTLGRARKQAVAREERDHLYRARKKCQFLLAWTNENEA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: zinc finger HIT-type containing 2
• Database Link:
  NP_055020
  Q9UHR6
• Background: The function of this protein remains unknown.
• Synonyms: C11orf5; FON
• Note: Immunogen Sequence Homology: Human: 100%; Yeast: 100%; Rat: 91%; Mouse: 90%; Dog: 86%; Pig: 86%; Bovine: 86%; Rabbit: 82%; Guinea pig: 82%

Reference Data