CDKL5 Rabbit Polyclonal Antibody

SKU TA342784

Rabbit Polyclonal Anti-CDKL5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDKL5 antibody: synthetic peptide directed towards the C terminal of human CDKL5. Synthetic peptide located within the following region: SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 115 kDa
• Gene Name: cyclin dependent kinase like 5
• Database Link:
  NP_003150
  O76039
• Background: CDKL5 is a member of Ser/Thr protein kinase family. This protein is a phosphorylated protein with protein kinase activity. Mutations in this CDKL5 gene have been associated with X-linked infantile spasm syndrome (ISSX), also known as X-linked West syndrome, and Rett syndrome (RTT).
• Synonyms: EIEE2; ISSX; STK9
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Druggable Genome, Protein Kinase